A18573
PRELP Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18573
- Zusätzliche Namen:
- MST161|MSTP161|PRELP|SLRR2A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 44kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- LDLQHNRLSDGVFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGN
- Uniprot:
- P51888
- Synonyme:
- 55 kDa leucine-rich repeat protein of articular cartilage;MST161;MSTP161;prolargin;prolargin proteoglycan;proline-arginine-rich end leucine-rich repeat protein;SLRR2A
- Weitere Details:
- The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed.
- Versandbedingungen:
- Blue Ice

