GTSF1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18534
Zusätzliche Namen:: Cue110|FAM112B|GTSF1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ
Uniprot:: Q8WW33
Synonyme:: Cue110;FAM112B;family with sequence similarity 112, member B;gametocyte-specific factor 1;Protein FAM112B
Weitere Details:: Predicted to enable metal ion binding activity. Predicted to be involved in cell differentiation and spermatogenesis. Predicted to be located in cytoplasm.