A18502
PANK2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18502
- Zusätzliche Namen:
- C20orf48|HARP|HSS|NBIA1|PANK2|PKAN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 63kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- RDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVY
- Uniprot:
- Q9BZ23
- Synonyme:
- C20orf48;Hallervorden-Spatz syndrome;HARP;HSS;NBIA1;pantothenate kinase 2, mitochondrial;pantothenate kinase-associated neurodegeneration;pantothenic acid kinase 2;PKAN
- Weitere Details:
- This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms.
- Versandbedingungen:
- Blue Ice

