ABTB1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18499
Zusätzliche Namen:: ABTB1|BPOZ|BTB3|BTBD21|EF1ABP|PP2259
Anwendung:: ELISA, WB
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFVVHGKPFRVHRCVLGARSAYF
Uniprot:: Q969K4
Synonyme:: ankyrin repeat and BTB (POZ) domain containing 1;ankyrin repeat and BTB/POZ domain-containing protein 1;BPOZ;BTB3;BTBD21;EF1ABP;elongation factor 1A-binding protein;PP2259
Weitere Details:: This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants.