C9orf114 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18460
Zusätzliche Namen:: C9orf114|CENP-32|CENP32|HSPC109
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: HQDLQFAGLLNPLDSPHHMRQDEESEFREGIVVDRPTRPGHGSFVNCGMKKEVKIDKNLEPGLRVTVRLNQQQHPDCKTYHGKVVSSQDPRTKAGLYWGYTVRLASCLSAVFAEAPFQDGYDLTIGTSERGSDVASAQLPNFRHALVVFGGLQGLEAGADADPNLEVAEPSVLFDLYV
Uniprot:: Q5T280
Synonyme:: C9orf114;CENP-32;CENP32;centromere protein 32;HSPC109;kinetochore-associated protein;putative methyltransferase C9orf114;SPOUT domain-containing methyltransferase 1
Weitere Details:: Enables miRNA binding activity. Involved in maintenance of centrosome location and production of miRNAs involved in gene silencing by miRNA. Located in kinetochore; mitotic spindle; and spindle pole centrosome.