A18451
REPIN1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18451
- Zusätzliche Namen:
- AP4|REPIN1|RIP60|Zfp464|ZNF464
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 64kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- SCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV
- Uniprot:
- Q9BWE0
- Synonyme:
- 60 kDa origin-specific DNA-binding protein;60 kDa replication initiation region protein;AP4;ATT-binding protein;DHFR oribeta-binding protein RIP60;H_DJ0584D14.12;replication initiation region protein (60kD);replication initiator 1;RIP60;Zfp464;Zinc finger protein 464;zinc finger protein 464 (RIP60);zinc finger protein AP4;ZNF464
- Weitere Details:
- Enables RNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of glucose import and regulation of fatty acid transport. Located in nucleoplasm.
- Versandbedingungen:
- Blue Ice

