A18402
SMC3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18402
- Zusätzliche Namen:
- BAM|BMH|CDLS3|CSPG6|HCAP|SMC3|SMC3L1
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 142kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- KEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHID
- Uniprot:
- Q9UQE7
- Synonyme:
- BAM;basement membrane-associated chondroitin proteoglycan;BMH;CDLS3;Chondroitin sulfate proteoglycan 6;chondroitin sulfate proteoglycan 6 (bamacan);chromosome-associated polypeptide;CSPG6;HCAP;SMC protein 3;SMC3L1;structural maintenance of chromosomes protein 3
- Weitere Details:
- This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
- Versandbedingungen:
- Blue Ice



