SLC5A3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18380
Zusätzliche Namen:: BCW2|SLC5A3|SMIT|SMIT1|SMIT2
Anwendung:: ELISA, WB
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: PPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGEKERKKETDDGGRYWKFIDWFCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVK
Uniprot:: P53794
Synonyme:: BCW2;Na(+)/myo-inositol cotransporter;SMIT;SMIT1;SMIT2;sodium/myo-inositol cotransporter;sodium/myo-inositol cotransporter 1;sodium/myo-inositol transporter 1;solute carrier family 5 (inositol transporters), member 3;solute carrier family 5 (sodium/myo-inositol cotransporter), member 3;Solute carrier family 5 member 3
Weitere Details:: Enables potassium channel regulator activity and transmembrane transporter binding activity. Predicted to be involved in inositol metabolic process; monosaccharide transmembrane transport; and myo-inositol import across plasma membrane. Predicted to act upstream of or within several processes, including peripheral nervous system development; positive regulation of reactive oxygen species biosynthetic process; and regulation of respiratory gaseous exchange. Located in plasma membrane. Part of perinuclear region of cytoplasm.

Versandbedingungen:: Blue Ice