CD47 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1838
Zusätzliche Namen:: CD47|IAP|MER6|OA3
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 45-50 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE
Uniprot:: Q08722
Synonyme:: antigen identified by monoclonal antibody 1D8;antigenic surface determinant protein OA3;CD47 antigen (Rh-related antigen, integrin-associated signal transducer);CD47 glycoprotein;IAP;integrin associated protein;Integrin-associated protein;integrin-associated signal transducer;leukocyte surface antigen CD47;MER6;OA3;Protein MER6;Rh-related antigen
Weitere Details:: This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.