TLE4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18345
Zusätzliche Namen:: BCE-1|BCE1|E(spI)|E(spl)|ESG|ESG4|Grg-4|GRG4|TLE4
Anwendung:: ELISA, WB
Molekulargewicht:: 84kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: SSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARY
Uniprot:: Q04727
Synonyme:: B lymphocyte gene 1;BCE-1;BCE1;E(spI);E(spl);enhancer of split groucho 4;ESG;ESG4;Grg-4;GRG4;groucho-related protein 4;transducin like enhancer of split 4;transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila);transducin-like enhancer of split 4, homolog of Drosophila E(sp1);transducin-like enhancer protein 4
Weitere Details:: Predicted to enable transcription corepressor activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway. Predicted to act upstream of or within Wnt signaling pathway; cellular response to leukemia inhibitory factor; and negative regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of beta-catenin-TCF complex.