TPX2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18327
Zusätzliche Namen:: C20orf1|C20orf2|DIL-2|DIL2|FLS353|GD:C20orf1|HCA519|HCTP4|p100|REPP86|TPX2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 105kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKMKAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKSTEEQELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKS
Uniprot:: Q9ULW0
Synonyme:: C20orf1;C20orf2;differentially expressed in cancerous and non-cancerous lung cells 2;differentially expressed in lung cells;DIL-2;DIL2;FLS353;GD:C20orf1;HCA519;HCTP4;hepatocellular carcinoma-associated antigen 519;hepatocellular carcinoma-associated antigen 90;p100;preferentially expressed in colorectal cancer;protein fls353;REPP86;restricted expression proliferation associated protein 100;Restricted expression proliferation-associated protein 100;targeting protein for Xklp2;TPX2, microtubule-associated protein homolog;TPX2, microtubule-associated, homolog
Weitere Details:: Enables importin-alpha family protein binding activity and protein kinase binding activity. Involved in activation of protein kinase activity; microtubule cytoskeleton organization; and negative regulation of microtubule depolymerization. Located in intercellular bridge; mitotic spindle; and nucleoplasm. Colocalizes with spindle pole.

Versandbedingungen:: Blue Ice