A18321
PEX11B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A18321
- Zusätzliche Namen:
- PEX11-BETA|PEX11B|PEX11beta|PEX14B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- DNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG
- Uniprot:
- O96011
- Synonyme:
- peroxin-11B;peroxisomal biogenesis factor 11B;peroxisomal membrane protein 11B;PEX11-BETA;PEX14B;protein PEX11 homolog beta
- Weitere Details:
- The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for this gene.
- Versandbedingungen:
- Blue Ice