MEIS1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18273
Zusätzliche Namen:: MEIS1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 51kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: PSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
Uniprot:: O00470
Synonyme:: homeobox protein Meis1;leukemogenic homolog protein;Meis1, myeloid ecotropic viral integration site 1 homolog;WUGSC:H_NH0444B04.1
Weitere Details:: Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.