OSR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18272
Zusätzliche Namen:: ODD|OSR1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: NGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKP
Uniprot:: Q8TAX0
Synonyme:: ODD;odd-skipped homolog;odd-skipped related 1;odd-skipped related transciption factor 1;protein odd-skipped-related 1
Weitere Details:: Enables sequence-specific double-stranded DNA binding activity. Involved in negative regulation of ion transmembrane transporter activity; positive regulation of gastrulation; and pronephros development. Located in nucleus.