A1827
GYPA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1827
- Zusätzliche Namen:
- CD235a|GPA|GPErik|GPSAT|GYPA|HGpMiV|HGpMiXI|HGpSta(C)|MN|MNS|PAS-2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
- Uniprot:
- P02724
- Synonyme:
- CD235a;erythroid-lineage-specific membrane sialoglycoprotein;glycophorin A (MN blood group);glycophorin A, GPA;glycophorin Erik;glycophorin MiI;glycophorin MiV;glycophorin SAT;glycophorin Sta type C;glycophorin-A;GPA;GPErik;GPSAT;HGpMiV;HGpMiXI;HGpSta(C);Mi.V glycoprotein (24 AA);MN;MN sialoglycoprotein;MNS;PAS-2;recombinant glycophorin A-B Miltenberger-DR;sialoglycoprotein alpha
- Weitere Details:
- Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.
- Versandbedingungen:
- Blue Ice

