PSMD6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18263
Zusätzliche Namen:: p42A|p44S10|PSMD6|Rpn7|S10|SGA-113M
Anwendung:: ELISA, WB
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: RFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQL
Uniprot:: Q15008
Synonyme:: 26S proteasome non-ATPase regulatory subunit 6;26S proteasome regulatory subunit RPN7;26S proteasome regulatory subunit S10;breast cancer-associated protein SGA-113M;p42A;p44S10;phosphonoformate immuno-associated protein 4;proteasome (prosome, macropain) 26S subunit, non-ATPase, 6;proteasome regulatory particle subunit p44S10;Rpn7;S10;SGA-113M
Weitere Details:: This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants