DPF2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18258
Zusätzliche Namen:: CSS7|DPF2|REQ|SMARCG2|ubi-d4|UBID4
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: DPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDAS
Uniprot:: Q92785
Synonyme:: apoptosis response zinc finger protein;BAF45D;BRG1-associated factor 45D;CSS7;D4, zinc and double PHD fingers family 2;protein requiem;REQ;requiem, apoptosis response zinc finger;SMARCG2;ubi-d4;UBID4;zinc finger protein ubi-d4
Weitere Details:: The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors.