Tulp2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18256
Zusätzliche Namen:: Pdet|Tulp2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FQSDSSWGLGVGSPFLQENVPQAHLPSGAHSALVTMSYVADGSGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEVTMEDIPVISRPPQTNLANLRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPDPTVNSDGDHGDLAPCKVEENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQGDDGDASNHNAWNMTCPQPRIPGPRLG
Uniprot:: P46686
Synonyme:: cancer testis antigen 65;CT65;Pdet;protein P4-6;testis specific phosphodiesterase;tubby like protein 2;Tubby-like protein 2;tubby-related protein 2;TUBL2
Weitere Details:: Predicted to enable phosphoric diester hydrolase activity. Predicted to be involved in protein localization to cilium. Predicted to be located in cytoplasm and extracellular region. Predicted to be active in cilium. Is expressed in urogenital ridge. Orthologous to human TULP2 (TUB like protein 2).