A18244
Mrpl55 Rabbit polyclonal antibody
Größe
Auf Anfrage
- SKU:
- A18244
- Zusätzliche Namen:
- 2810038N09Rik|L55mt|MRP-L55|Mrpl55
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 13-14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- DCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK
- Uniprot:
- Q9CZ83
- Synonyme:
- 2810038N09Rik;39S ribosomal protein L55, mitochondrial;AAVG5835;L55mt;L55nt;mitochondrial large ribosomal subunit protein bL31m;mitochondrial large ribosomal subunit protein mL55;MRP-L55;PRO19675
- Weitere Details:
- Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Located in mitochondrion. Is expressed in several structures, including early conceptus; gonad; heart; liver; and metanephros. Orthologous to human MRPL55 (mitochondrial ribosomal protein L55).
- Versandbedingungen:
- Blue Ice