MRPL55 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A18242
Zusätzliche Namen:: AAVG5835|L55nt|MRP-L55|MRPL55|PRO19675
Anwendung:: ELISA, WB
Molekulargewicht:: 15kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
Uniprot:: Q7Z7F7
Synonyme:: 39S ribosomal protein L55, mitochondrial;AAVG5835;L55mt;L55nt;mitochondrial large ribosomal subunit protein bL31m;mitochondrial large ribosomal subunit protein mL55;MRP-L55;PRO19675
Weitere Details:: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding two different isoforms were identified through sequence analysis.

Versandbedingungen:: Blue Ice