A18238
MED15 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18238
- Zusätzliche Namen:
- ARC105|CAG7A|CTG7A|MED15|PCQAP|TIG-1|TIG1|TNRC7
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 87kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIG
- Uniprot:
- Q96RN5
- Synonyme:
- activator-recruited cofactor 105 kDa component;activator-recruited cofactor, 105-kD;ARC105;CAG7A;CTG repeat protein 7a;CTG7A;Mediator complex subunit 15;mediator of RNA polymerase II transcription subunit 15;PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein;PC2 glutamine/Q-rich-associated protein;PC2-glutamine-rich-associated protein;PCQAP;Positive cofactor 2 glutamine/Q-rich-associated protein;positive cofactor 2, glutamine/Q-rich-associated protein;TIG-1;TIG1;TNRC7;TPA inducible gene-1;TPA inducible protein;TPA-inducible gene 1 protein;trinucleotide repeat containing 7;trinucleotide repeat-containing gene 7 protein
- Weitere Details:
- The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice



