A1823
HSD3B2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1823
- Zusätzliche Namen:
- HSD3B|HSD3B2|HSDB|SDR11E2
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 42 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPL
- Uniprot:
- P26439
- Synonyme:
- 3 beta-HSD type II;3 beta-hydroxysteroid dehydrogenase type II, delta 5-delta 4-isomerase type II, 3 beta-HSD type II;3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2;3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II;3-beta-HSD adrenal and gonadal type;3-beta-HSD II;3-beta-hydroxy-5-ene steroid dehydrogenase;3-beta-hydroxy-Delta(5)-steroid dehydrogenase;delta 5-delta 4-isomerase type II;HSD3B;HSDB;progesterone reductase;SDR11E2;short chain dehydrogenase/reductase family 11E, member 2
- Weitere Details:
- The protein encoded by this gene is a bifunctional enzyme that catalyzes the oxidative conversion of delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. It plays a crucial role in the biosynthesis of all classes of hormonal steroids. This gene is predominantly expressed in the adrenals and the gonads. Mutations in this gene are associated with 3-beta-hydroxysteroid dehydrogenase, type II, deficiency. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice