CXCL12 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A18225
Zusätzliche Namen:: CXCL12|IRH|PBSF|SCYB12|SDF1|TLSF|TPAR1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 11kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: ARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Uniprot:: P48061
Synonyme:: C-X-C motif chemokine 12;chemokine (C-X-C motif) ligand 12;intercrine reduced in hepatomas;IRH;PBSF;pre-B cell growth-stimulating factor;SCYB12;SDF1;stromal cell-derived factor 1;TLSF;TPAR1
Weitere Details:: This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.