HSPB11 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A18224
Zusätzliche Namen:: C1orf41|CFAP232|FAP232|HSPB11|HSPCO34|PP25
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Uniprot:: Q9Y547
Synonyme:: C1orf41;FAP232;heat shock protein beta-11;heat shock protein family B (small), member 11;HSPCO34;IFT25;intraflagellar transport 25 homolog;intraflagellar transport protein 25 homolog;placental protein 25;PP25
Weitere Details:: Predicted to enable metal ion binding activity. Predicted to be involved in kidney development and spermatogenesis. Predicted to act upstream of or within animal organ development; left/right axis specification; and skeletal system development. Predicted to be located in ciliary tip. Predicted to be part of intraciliary transport particle B. Predicted to be active in centrosome and cilium.