A18223
NAPB Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18223
- Zusätzliche Namen:
- DEE107|NAPB|SNAP-BETA|SNAPB
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN
- Uniprot:
- Q9H115
- Synonyme:
- beta-soluble NSF attachment protein;N-ethylmaleimide-sensitive factor attachment protein beta;N-ethylmaleimide-sensitive factor attachment protein, beta;SNAP-BETA;SNAPB
- Weitere Details:
- This gene encodes a member of the soluble N-ethyl-maleimide-sensitive fusion attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. This gene encodes the SNAP beta isoform which has been shown to be preferentially expressed in brain tissue. The encoded protein also interacts with the GluR2 α-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) receptor subunit C-terminus and may play a role as a chaperone in the molecular processing of the AMPA receptor.
- Versandbedingungen:
- Blue Ice

