NAPB Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18223
Zusätzliche Namen:: DEE107|NAPB|SNAP-BETA|SNAPB
Anwendung:: ELISA, WB
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN
Uniprot:: Q9H115
Synonyme:: beta-soluble NSF attachment protein;N-ethylmaleimide-sensitive factor attachment protein beta;N-ethylmaleimide-sensitive factor attachment protein, beta;SNAP-BETA;SNAPB
Weitere Details:: This gene encodes a member of the soluble N-ethyl-maleimide-sensitive fusion attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. This gene encodes the SNAP beta isoform which has been shown to be preferentially expressed in brain tissue. The encoded protein also interacts with the GluR2 α-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) receptor subunit C-terminus and may play a role as a chaperone in the molecular processing of the AMPA receptor.