A18211
ERCC6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A18211
- Zusätzliche Namen:
- ARMD5|CKN2|COFS|COFS1|CSB|CSB-PGBD3|ERCC6|POF11|RAD26|UVSS1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 168kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- LPVFMEQFSVPITMGGYSNASPVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFVDSKEVYRILNGEMQIFSGLI
- Uniprot:
- Q03468
- Synonyme:
- ARMD5;ATP-dependent helicase ERCC6;Chimeric CSB-PGBD3 protein;Chimeric ERCC6-PGBD3 protein;CKN2;Cockayne syndrome group B protein;cockayne syndrome protein CSB;COFS;COFS1;CSB;CSB-PGBD3;DNA excision repair protein ERCC-6;ERCC6-PGBD3 fusion protein;excision repair cross-complementation group 6;excision repair cross-complementing rodent repair deficiency, complementation group 6;POF11;RAD26;UVSS1
- Weitere Details:
- This gene encodes a DNA-binding protein that is important in transcription-coupled excision repair. The encoded protein has ATP-stimulated ATPase activity, interacts with several transcription and excision repair proteins, and may promote complex formation at DNA repair sites. Mutations in this gene are associated with Cockayne syndrome type B and cerebrooculofacioskeletal syndrome 1. Alternative splicing occurs between a splice site from exon 5 of this gene to the 3' splice site upstream of the open reading frame (ORF) of the adjacent gene, piggyback-derived-3 (GeneID:267004), which activates the alternative polyadenylation site downstream of the piggyback-derived-3 ORF. The resulting transcripts encode a fusion protein that shares sequence with the product of each individual gene.
- Versandbedingungen:
- Blue Ice