BTBD7 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A18206
Zusätzliche Namen:: BTBD7|FUP1
Anwendung:: ELISA, WB
Molekulargewicht:: 126kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: ASNYPHSCSPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSGLATLKKKFIKRRK
Uniprot:: Q9P203
Synonyme:: BTB (POZ) domain containing 7;BTB/POZ domain-containing protein 7;FUP1
Weitere Details:: Predicted to be involved in regulation of branching involved in salivary gland morphogenesis. Predicted to be located in nucleus.