S1PR2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18205
Zusätzliche Namen:: AGR16|DFNB68|EDG-5|EDG5|Gpcr13|H218|LPB2|S1P2|S1PR2
Anwendung:: ELISA, WB
Molekulargewicht:: 40-50kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: FSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
Uniprot:: O95136
Synonyme:: AGR16;CTD-2369P2.2;deafness, autosomal recessive 68;DFNB68;EDG-5;EDG5;endothelial differentiation G-protein coupled receptor 5;endothelial differentiation, sphingolipid G-protein-coupled receptor, 5;Gpcr13;H218;LPB2;S1P receptor 2;S1P receptor Edg-5;S1P receptor EDG5;S1P2;sphingosine 1-phosphate receptor 2;sphingosine 1-phosphate receptor Edg-5
Weitere Details:: This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. The encoded protein is a receptor for sphingosine 1-phosphate, which participates in cell proliferation, survival, and transcriptional activation. Defects in this gene have been associated with congenital profound deafness.