A18203
EIF2B4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A18203
- Zusätzliche Namen:
- EIF-2B|EIF2B|EIF2B4|EIF2Bdelta
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 57kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- EMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAEL
- Uniprot:
- Q9UI10
- Synonyme:
- EIF-2B;eIF-2B GDP-GTP exchange factor subunit delta;EIF2B;EIF2Bdelta;eukaryotic translation initiation factor 2B subunit 4 delta;eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa;translation initiation factor eIF-2b delta subunit;translation initiation factor eIF-2B subunit delta
- Weitere Details:
- Eukaryotic initiation factor 2B (EIF2B), which is necessary for protein synthesis, is a GTP exchange factor composed of five different subunits. The protein encoded by this gene is the fourth, or delta, subunit. Defects in this gene are a cause of leukoencephalopathy with vanishing white matter (VWM) and ovarioleukodystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice