A1818
EIF6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1818
- Zusätzliche Namen:
- b(2)gcn|CAB|eIF-6|EIF3A|EIF6|ITGB4BP|p27(BBP)|p27BBP
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
- Uniprot:
- P56537
- Synonyme:
- b(2)gcn;B(2)GCN homolog;B4 integrin interactor;CAB;eIF-6;EIF3A;eukaryotic translation initiation factor 3A;eukaryotic translation initiation factor 6;ITGB4BP;p27 beta-4 integrin-binding protein;p27(BBP);p27BBP
- Weitere Details:
- Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice