BMPR1A Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A1816
Zusätzliche Namen:: 10q23del|ACVRLK3|ALK-3|ALK3|BMPR-1A|BMPR1A|CD292|SKR5
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFI
Uniprot:: P36894
Synonyme:: 10q23del;activin A receptor, type II-like kinase 3;activin receptor-like kinase 3;ACVRLK3;ALK-3;ALK3;BMP type-1A receptor;BMPR-1A;bone morphogenetic protein receptor type-1A;bone morphogenetic protein receptor, type IA;CD292;serine/threonine-protein kinase receptor R5;SKR5
Weitere Details:: The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding.

Versandbedingungen:: Blue Ice