Tenascin C Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18156
Zusätzliche Namen:: 150-225|DFNA56|GMEM|GP|HXB|JI|Tenascin C|TN|TN-C
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 240-260kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: NGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Uniprot:: P24821
Synonyme:: 150-225;cytotactin;deafness, autosomal dominant 56;DFNA56;glioma-associated-extracellular matrix antigen;GMEM;GP;GP 150-225;Hexabrachion;hexabrachion (tenascin);HXB;JI;myotendinous antigen;neuronectin;tenascin;Tenascin-C;tenascin-C additional domain 1;TN;TN-C
Weitere Details:: This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration.