A1814
SLC22A6 Rabbit polyclonal antibody
Größe
Auf Anfrage
- SKU:
- A1814
- Zusätzliche Namen:
- HOAT1|OAT1|PAHT|ROAT1|SLC22A6
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 62kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQ
- Uniprot:
- Q4U2R8
- Synonyme:
- HOAT1;hPAHT;hROAT1;OAT1;organic anion transporter 1;PAH transporter;PAHT;para-aminohippurate transporter;renal organic anion transporter 1;ROAT1;solute carrier family 22 (organic anion transporter), member 6;solute carrier family 22 member 6
- Weitere Details:
- The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice