ANGPTL8 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A18133
Zusätzliche Namen:: ANGPTL8|C19orf80|PRO1185|PVPA599|RIFL|TD26
Anwendung:: ELISA, WB
Molekulargewicht:: 24 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Uniprot:: Q6UXH0
Synonyme:: angiopoietin-like protein 8;Betatrophin;betatrophin variant 1;betatrophin variant 2;C19orf80;hepatocellular carcinoma-associated gene TD26;hepatocellular carcinoma-associated protein TD26;lipasin;PRO1185;PVPA599;refeeding-induced fat and liver protein;RIFL;TD26
Weitere Details:: Predicted to enable hormone activity. Involved in regulation of lipid metabolic process and triglyceride homeostasis. Acts upstream of or within positive regulation of protein processing and regulation of lipoprotein metabolic process. Located in extracellular region.