Fyn Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A18127
Zusätzliche Namen:: Fyn|p59-FYN|SLK|SYN
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 61kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
Uniprot:: P06241
Synonyme:: c-syn protooncogene;FYN oncogene related to SRC, FGR, YES;OKT3-induced calcium influx regulator;p59-FYN;proto-oncogene c-Fyn;proto-oncogene Syn;SLK;src-like kinase;src/yes-related novel;SYN;tyrosine kinase p59fyn(T);tyrosine-protein kinase Fyn
Weitere Details:: This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.