A1810
SDC2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1810
- Zusätzliche Namen:
- CD362|HSPG|HSPG1|SDC2|SYND2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 50kDa/22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE
- Uniprot:
- P34741
- Synonyme:
- CD362;cell surface-associated heparan sulfate proteoglycan 1;fibroglycan;heparan sulfate proteoglycan 1, cell surface-associated;heparan sulfate proteoglycan core protein;HSPG;HSPG1;SYND2;syndecan proteoglycan 2;syndecan-2
- Weitere Details:
- The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types.
- Versandbedingungen:
- Blue Ice







