A1802
ALDH1A1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1802
- Zusätzliche Namen:
- ALDC|ALDH-E1|ALDH1|ALDH11|ALDH1A1|HEL-9|HEL-S-53e|HEL12|PUMB1|RALDH1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
- Uniprot:
- P00352
- Synonyme:
- acetaldehyde dehydrogenase 1;ALDC;aldehyde dehydrogenase 1, soluble;Aldehyde dehydrogenase family 1 member A1;Aldehyde dehydrogenase, cytosolic;aldehyde dehydrogenase, liver cytosolic;ALDH class 1;ALDH-E1;ALDH1;ALDH11;ALHDII;epididymis luminal protein 12;epididymis luminal protein 9;epididymis secretory sperm binding protein Li 53e;HEL-9;HEL-S-53e;HEL12;PUMB1;RALDH 1;RALDH1;retinal dehydrogenase 1;retinaldehyde dehydrogenase 1
- Weitere Details:
- The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.
- Versandbedingungen:
- Blue Ice