A18019
AKT2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18019
- Zusätzliche Namen:
- AKT2|HIHGHH|PKBB|PKBBETA|PRKBB|RAC-BETA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
- Uniprot:
- P31751
- Synonyme:
- HIHGHH;murine thymoma viral (v-akt) homolog-2;PKB beta;PKBB;PKBBETA;PRKBB;protein kinase Akt-2;protein kinase B beta;putative v-akt murine thymoma viral oncoprotein 2;rac protein kinase beta;RAC-BETA;RAC-beta serine/threonine-protein kinase;RAC-PK-beta;v-akt murine thymoma viral oncogene homolog 2
- Weitere Details:
- This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains, which is involved in signaling pathways. The gene serves as an oncogene in the tumorigenesis of cancer cells For example, its overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins, and has also been implicated in insulin signaling.
- Versandbedingungen:
- Blue Ice



_WB_01.jpg)