A17982
ZDHHC20 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17982
- Zusätzliche Namen:
- 4933421L13Rik|DHHC-20|DHHC20|ZDHHC20
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- VFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN
- Uniprot:
- Q5W0Z9
- Synonyme:
- 4933421L13Rik;acyltransferase ZDHHC20;DHHC domain-containing cysteine-rich protein 20;DHHC-20;DHHC20;palmitoyltransferase ZDHHC20;probable palmitoyltransferase ZDHHC20;zinc finger DHHC domain-containing protein 20;zinc finger DHHC-type containing 20
- Weitere Details:
- Enables protein-cysteine S-palmitoyltransferase activity and zinc ion binding activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in intracellular membrane-bounded organelle and plasma membrane. Is integral component of Golgi membrane.
- Versandbedingungen:
- Blue Ice

