ZDHHC20 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17982
Zusätzliche Namen:: 4933421L13Rik|DHHC-20|DHHC20|ZDHHC20
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: VFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN
Uniprot:: Q5W0Z9
Synonyme:: 4933421L13Rik;acyltransferase ZDHHC20;DHHC domain-containing cysteine-rich protein 20;DHHC-20;DHHC20;palmitoyltransferase ZDHHC20;probable palmitoyltransferase ZDHHC20;zinc finger DHHC domain-containing protein 20;zinc finger DHHC-type containing 20
Weitere Details:: Enables protein-cysteine S-palmitoyltransferase activity and zinc ion binding activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in intracellular membrane-bounded organelle and plasma membrane. Is integral component of Golgi membrane.