A17976
POU1F1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17976
- Zusätzliche Namen:
- CPHD1|GHF-1|Pit-1|PIT1|POU1F1|POU1F1a
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 35kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- MDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
- Uniprot:
- P28069
- Synonyme:
- CPHD1;GHF-1;growth hormone factor 1;Pit-1;PIT1;pituitary transcript factor 1;pituitary-specific positive transcription factor 1;POU domain, class 1, transcription factor 1;POU1F1a
- Weitere Details:
- This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

