OVOL2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17973
Zusätzliche Namen:: CHED|CHED1|CHED2|EUROIMAGE566589|OVOL2|PPCD1|ZNF339
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: DEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQ
Uniprot:: Q9BRP0
Synonyme:: CHED;CHED1;CHED2;corneal endothelial dystrophy 1 (autosomal dominant);EUROIMAGE566589;PPCD1;transcription factor Ovo-like 2;zinc finger protein 339;ZNF339
Weitere Details:: This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intrinsically disordered domains. Members of this family are involved in epithelial development and differentiation. Knockout of this gene in mouse results in early embryonic lethality with phenotypes that include neurectoderm expansion, impaired vascularization, and heart anomalies. In humans, allelic variants of this gene have been associated with posterior polymorphous corneal dystrophy.