MTCO2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17965
Zusätzliche Namen:: COII|COX2|MTCO2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSI
Uniprot:: P00403
Synonyme:: COII;Cytochrome c oxidase polypeptide II;cytochrome c oxidase subunit II;MTCO2
Weitere Details:: Contributes to cytochrome-c oxidase activity. Predicted to be involved in mitochondrial electron transport, cytochrome c to oxygen and positive regulation of vasoconstriction. Located in mitochondrial inner membrane. Part of respiratory chain complex IV. Biomarker of Huntington's disease and stomach cancer.