PXDN Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17929
Zusätzliche Namen:: ASGD7|COPOA|D2S448|D2S448E|hsPxd01|MG50|PRG2|PXDN|PXN|VPO
Anwendung:: ELISA, WB
Molekulargewicht:: 165 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: RTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP
Uniprot:: Q92626
Synonyme:: ASGD7;COPOA;D2S448;D2S448E;melanoma-associated antigen MG50;MG50;p53-responsive gene 2 protein;peroxidasin homolog;PRG2;PXN;vascular peroxidase 1;VPO
Weitere Details:: This gene encodes a heme-containing peroxidase that is secreted into the extracellular matrix. It is involved in extracellular matrix formation, and may function in the physiological and pathological fibrogenic response in fibrotic kidney. Mutations in this gene cause corneal opacification and other ocular anomalies, and also microphthalmia and anterior segment dysgenesis.