pan-PKC Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17922
Zusätzliche Namen:: pan-PKC|PRKCA/PRKCB/PRKCD/PRKCE/PRKCH/PRKCQ
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 83kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Uniprot:: P05771, P17252, P24723, Q02156, Q04759, Q05655
Synonyme:: AAG6;aging-associated gene 6;ALPS3;CVID9;MAY1;nPKC-delta;nPKC-epsilon;nPKC-eta;nPKC-theta;PKC-A;PKC-alpha;PKC-B;PKC-beta;PKC-L;PKCA;PKCalpha;PKCB;PKCbeta;PKCD;PKCE;PKCI(2);PKCI+/-;PKCL;PRKACA;PRKCB1;PRKCB2;PRKCL;PRKCT;protein kinase C alpha type;protein kinase C beta type;protein kinase C delta type;protein kinase C delta VIII;protein kinase C epsilon type;protein kinase C eta type;protein kinase C theta type;protein kinase C, beta 1 polypeptide;tyrosine-protein kinase PRKCD
Weitere Details:: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption.

Versandbedingungen:: Blue Ice