Bmi1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A17914
Zusätzliche Namen:: Bmi1|flvi-2/bmi-1|FLVI2/BMI1|PCGF4|RNF51
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
Uniprot:: P35226
Synonyme:: B lymphoma Mo-MLV insertion region 1 homolog;BMI1;BMI1 polycomb ring finger oncogene;BMI1 polycomb ring finger proto-oncogene;COMMD3-BMI1 read-through protein;flvi-2/bmi-1;FLVI2/BMI1;murine leukemia viral (bmi-1) oncogene homolog;PCGF4;polycomb complex protein BMI-1;polycomb group protein Bmi1;polycomb group RING finger protein 4;ring finger protein 51;RNF51
Weitere Details:: This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene.

Versandbedingungen:: Blue Ice