A17911
[KO Validated] APP Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A17911
- Zusätzliche Namen:
- AAA|ABETA|ABPP|AD1|alpha-sAPP|APPI|CTFgamma|CVAP|PN-II|PN2|PP|preA4
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 100-140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
- Uniprot:
- P05067
- Synonyme:
- AAA;ABETA;ABPP;AD1;alpha-sAPP;alzheimer disease amyloid protein;amyloid beta (A4) precursor protein;amyloid beta A4 protein;amyloid precursor protein;amyloid-beta precursor protein;APPI;beta-amyloid peptide;beta-amyloid peptide(1-40);beta-amyloid peptide(1-42);beta-amyloid precursor protein;cerebral vascular amyloid peptide;CTFgamma;CVAP;peptidase nexin-II;PN-II;PN2;preA4;protease nexin-II;testicular tissue protein Li 2
- Weitere Details:
- This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_1.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_2.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_3.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_4.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_5.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_ARC0465_KO-WB_01.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_ARC0465_WB_01.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_ARC0465-01_IHC_01.jpg)
![[KO Validated] APP Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A17911/A17911_ARC0465-01_IHC_02.jpg)