ABCG1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A17907
Zusätzliche Namen:: ABC8|ABCG1|WHITE1
Anwendung:: ELISA, WB
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEI
Uniprot:: P45844
Synonyme:: ABC transporter 8;ABC8;ATP-binding cassette sub-family G member 1;ATP-binding cassette transporter 8;ATP-binding cassette transporter member 1 of subfamily G;ATP-binding cassette, sub-family G (WHITE), member 1;homolog of Drosophila white;White protein homolog;white protein homolog (ATP-binding cassette transporter 8);WHITE1
Weitere Details:: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.