ZC3H12D Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17881
Zusätzliche Namen:: C6orf95|dJ281H8.1|MCPIP4|p34|TFL|ZC3H12D
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QHVLAELERQAVLVYTPSRKVHGKRLVCYDDRYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMP
Uniprot:: A2A288
Synonyme:: C6orf95;dJ281H8.1;MCP-induced protein 4;MCPIP4;p34;probable ribonuclease ZC3H12D;TFL;transformed follicular lymphoma;tumor suppressor TFL;Zinc finger CCCH domain-containing protein 12D
Weitere Details:: Predicted to enable endoribonuclease activity and mRNA binding activity. Involved in negative regulation of G1/S transition of mitotic cell cycle and negative regulation of cell growth. Located in P-body and nucleoplasm.