Enpp1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17876
Zusätzliche Namen:: 4833416E15Rik|CD203c|E-NPP 1|E-NPP1|Enpp1|Ly-41|M6S1|NPP1|Npps|PC-1|Pca|Pca-1|Pdnp1|ttw|twy
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 120kDa/170kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PIYNPSHPKEEGFLSQCPIKSTSNDLGCTCDPWIVPIKDFEKQLNLTTEDDDIYHMTVPYGRPRILLKQHRVCLLQQQQFLTGYSLDLLMPLWASYTFLSNDQFSRDDFSNCLYQDLRIPLSPVHKCSYYKSNSKLSYGFLTPPRLNRVSN
Uniprot:: G3X9S2
Synonyme:: 4833416E15Rik;AI428932;alkaline phosphodiesterase 1;ARHR2;C76301;CD203c;COLED;E-N;E-NPP 1;E-NPP1;ectonucleotide pyrophosphatase/phosphodiesterase family member 1;Ly-4;Ly-41;Ly-41 antigen;lymphocyte antigen 41;M6S1;membrane component, chromosome 6, surface marker 1;N;NPP1;NPPS;P;PC-;PC-1;Pca;Pca-1;PCA1;Pd;PDNP1;phosphodiesterase I/nucleotide pyrophosphatase 1;plasma-cell membrane glycoprotein 1;plasma-cell membrane glycoprotein PC-1;tiptoe walking;ttw;twy
Weitere Details:: This gene encodes a member of the nucleoside pyrophosphatase/phosphodiesterase family of enzymes that catalyzes the hydrolysis of pyrophosphate and phosphodiester bonds in nucleotide triphosphates and oligonucleotides, respectively, to generate nucleoside 5'-monophosphates. The encoded protein is a type II transmembrane glycoprotein that negatively regulates bone mineralization. Mice harboring a nonsense mutation in this gene, termed tiptoe walking (ttw), exhibit ectopic ossification of the spinal ligaments. The encoded protein binds to the insulin receptor, inhibits downstream signaling events and induces insulin resistance and glucose tolerance. This gene is located adjacent to a paralog on chromosome 10. Alternative splicing results in multiple transcript variants encoding different isoforms.

Versandbedingungen:: Blue Ice