A17873
SSR3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17873
- Zusätzliche Namen:
- SSR3|TRAPG
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLF
- Uniprot:
- Q9UNL2
- Synonyme:
- signal sequence receptor subunit gamma;signal sequence receptor, gamma (translocon-associated protein gamma);SSR gamma;translocon-associated protein gamma subunit;translocon-associated protein subunit gamma;TRAP-complex gamma subunit;TRAP-gamma;TRAPG
- Weitere Details:
- The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. This gene encodes the gamma subunit, which is predicted to span the membrane four times.
- Versandbedingungen:
- Blue Ice